Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human ZNHIT1, His-tagged

Cat.No. : ZNHIT1-31745TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-154 of Human ZNHIT1 with N terminal His tag; Predicted MWt 19kDa.
  • Specification
  • Gene Information
  • Related Products
Description : ZNHIT1, Zinc finger HIT domain containing protein 1, appears to play a role in p53-mediated apoptosis induction.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 111 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNF QDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKL RFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPF CAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV
Gene Name : ZNHIT1 zinc finger, HIT-type containing 1 [ Homo sapiens ]
Official Symbol : ZNHIT1
Synonyms : ZNHIT1; zinc finger, HIT-type containing 1; zinc finger protein, subfamily 4A (HIT domain containing), member 1 , zinc finger, HIT domain containing 1 , ZNFN4A1; zinc finger HIT domain-containing protein 1; CG1I; H_DJ0747G18.14; putative cyclin G1 intera
Gene ID : 10467
mRNA Refseq : NM_006349
Protein Refseq : NP_006340
Uniprot ID : O43257
Chromosome Location : 7q22.1
Function : metal ion binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All ZNHIT1 Products

Required fields are marked with *

My Review for All ZNHIT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends