Recombinant Human ZSCAN21, His-tagged
Cat.No. : | ZSCAN21-31654TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 178-473 of Human ZFP38 with N terminal His tag; MWt 44 kDa ; |
- Specification
- Gene Information
- Related Products
Description : | Zinc finger and SCAN domain-containing protein 21 is a protein that in humans is encoded by the ZSCAN21 gene. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 85 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LYIQESGEEQEFAQDPRKVRDCRLSTQHEESADEQKGSEA EGLKGDIISVIIANKPEASLERQCVNLENEKGTKPPLQ EAGSKKGRESVPTKPTPGERRYICAECGKAFSNSSNLT KHRRTHTGEKPYVCTKCGKAFSHSSNLTLHYRTHLVDR PYDCKCGKAFGQSSDLLKHQRMHTEEAPYQCKDCGKAFSG KGSLIRHYRIHTGEKPYQCNECGKSFSQHAGLSSHQRL HTGEKPYKCKECGKAFNHSSNFNKHHRIHTGEKPYWCH HCGKTFCSKSNLSKHQRVHTGEGEAP |
Gene Name : | ZSCAN21 zinc finger and SCAN domain containing 21 [ Homo sapiens ] |
Official Symbol : | ZSCAN21 |
Synonyms : | ZSCAN21; zinc finger and SCAN domain containing 21; zinc finger protein 38 , zinc finger protein 38 (KOX 25) , ZNF38; zinc finger and SCAN domain-containing protein 21; DKFZp434L134; NY REN 21; Zipro1; |
Gene ID : | 7589 |
mRNA Refseq : | NM_145914 |
Protein Refseq : | NP_666019 |
MIM : | 601261 |
Uniprot ID : | Q9Y5A6 |
Chromosome Location : | 7q11.1 |
Function : | DNA binding; metal ion binding; protein binding; sequence-specific DNA binding transcription factor activity; zinc ion binding; |
Products Types
◆ Recombinant Protein | ||
Zscan21-7129M | Recombinant Mouse Zscan21 Protein, Myc/DDK-tagged | +Inquiry |
ZSCAN21-10502M | Recombinant Mouse ZSCAN21 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZSCAN21-119H | Recombinant Human ZSCAN21 protein, His-tagged | +Inquiry |
ZSCAN21-5284H | Recombinant Human ZSCAN21 protein, His-tagged | +Inquiry |
ZSCAN21-19239M | Recombinant Mouse ZSCAN21 Protein | +Inquiry |
◆ Lysates | ||
ZSCAN21-9185HCL | Recombinant Human ZSCAN21 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All ZSCAN21 Products
Required fields are marked with *
My Review for All ZSCAN21 Products
Required fields are marked with *
0
Inquiry Basket