"FGF2" Related Products

GMP Recombinant Human FGF2 protein

Cat.No.: FGF2-4345HG
Product Overview: Recombinant Human FGF2 was produced in E. coli using non-animal reagents in an animal-free facility under cGMP guidelines.
Description: Fibroblast Growth Factor-basic (bFGF) is a single-chain polypeptide growth factor that plays a significant role in the process of wound healing and is a potent inducer of angiogenesis. Several different forms of the human protein exist ranging from 18-24 kDa in size due to the use of alternative start sites within the fgf-2 gene. It has a 55 percent amino acid residue identity to FGF-1 and has potent heparin-binding activity. The growth factor is an extremely potent inducer of DNA synthesis in a variety of cell types from mesoderm and neuroectoderm lineages. It was originally named basic fibroblast growth factor based upon its chemical properties and to distinguish it from acidic fibroblast growth factor.Other homologous FGF belonging to the same family are int-2 ( FGF-3 ), FGF-5 , FGF-6 , K-FGF and KGF ( keratinocyte growth factor = FGF-7 ). All factors are products of different genes, some of which are Oncogene products (FGF-3, FGF-4, FGF-5 ).
Source: E. coli
Species: Human
Form: Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity: The ED50 determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.6 ng/mL, corresponding to a specific activity of >1.7 × 10^6 IU/mg.
Molecular Mass: Approximately 16.5 kDa, a single non-glycosylated polypeptide chain containing 147 amino acids.
AA Sequence: MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Endotoxin: Less than 1 EU/μg of the protein by LAL method.
Purity: >96% by SDS-PAGE and HPLC analyses.
Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably des centigradecated. Upon reconsitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw centigrade centigradeles.
Reconstitution: Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Quality Statement: Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing.
Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.
Gene Name: FGF2 fibroblast growth factor 2 (basic) [ Homo sapiens ]
Official Symbol: FGF2
Synonyms: FGF2; fibroblast growth factor 2 (basic); FGFB; fibroblast growth factor 2; prostatropin; heparin-binding growth factor 2; basic fibroblast growth factor bFGF; BFGF; FGF-2; HBGF-2;
Gene ID: 2247
mRNA Refseq: NM_002006
Protein Refseq: NP_001997
MIM: 134920
UniProt ID: P09038

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.