GMP Recombinant Human IL9 protein

Cat.No.: IL9-4324HG
Product Overview: Recombinant Human IL9 was produced in E. coli using non-animal reagents in an animal-free facility under cGMP guidelines.
Description: Interleukin-9 (IL-9) is encoded by the IL9 gene and produced by T-cells and specifically by CD4+ helper cells. IL-9 was originally identified as a cytokine found in the conditioned medium of a human T cell leukemia virus type I (HTLVI) transformed T cell line. It functions through the IL-9 receptor, which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. IL-9 can support the growth of IL-2 independent and IL-4 independent helper T-cells. Human IL-9 has approximately 56 % amino acid sequence identity with murine IL-9. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyper-responsiveness.
Source: E. coli
Species: Human
Form: Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4.
Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human MO7e cells is less than 0.2 ng/ml, corresponding to a specific activity of > 5.0 × 10^6 IU/mg.
Molecular Mass: Approximately 14.1 kDa, a single non-glycosylated polypeptide chain containing 126 amino acids.
AA Sequence: QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Endotoxin: Less than 1 EU/µg of rHuIL-9 as determined by LAL method.
Purity: > 95 % by SDS-PAGE and HPLC analyses.
Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw cycles.
Reconstitution: Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Quality Statement: Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing.
Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.
Gene Name: IL9 interleukin 9 [ Homo sapiens (human) ]
Official Symbol: IL9
Synonyms: P40; HP40; IL-9; Cytokine P40, T-cell Growth Factor P40
Gene ID: 3578
mRNA Refseq: NM_000590.1
Protein Refseq: NP_000581.1
MIM: 146931
UniProt ID: P15248

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.