Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Toxin > Recombinant A. sulcata ATX II

Recombinant A. sulcata ATX II

   Share
"ATX II" Related Products.
By Species
By Source
E. coli(1)
Cat.No.:
ATX II-254A
Product Overview:
Recombinant A. sulcata ATX II was expresed in E. coli.
Description:
rATX II is a 47 amino acid peptidyl toxin, originally isolated from Anemonia sulcata sea anemone venom. It is a potent neurotoxin, which modulates voltage-gated sodium channel gating kinetics by delaying its inactivation and prolonging the action potential of excitable membranes. ATX II has been used as a powerful activator of TTX-sensitive and insensitive sodium channels in various excitable tissue and cell types (at concentration range of 10-100 nM).
Source:
E. coli
Species:
A. sulcata
Molecular Mass:
~4935 Da
AA Sequence:
GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ
Purity:
≥98%
Stability:
~2 years at -20 centigrade. Upon reconstitution, store solutions in working aliquots at -20 centigrade. When stored properly, the solutions are stable for at least three months.
Storage:
Store at -20 centigrade
Reconstitution:
Reconstitute with distilled water or any aqueous buffer. Dissolving 50μg in 1.01 mL of any conventional buffer gives a stock solution of 10μM.
Synonyms:
ATX II


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2017 Creative Biomart. All Rights Reserved.