"ATX II" Related Products

Recombinant A. sulcata ATX II

Cat.No.: ATX II-254A
Product Overview: Recombinant A. sulcata ATX II was expresed in E. coli.
Description: rATX II is a 47 amino acid peptidyl toxin, originally isolated from Anemonia sulcata sea anemone venom. It is a potent neurotoxin, which modulates voltage-gated sodium channel gating kinetics by delaying its inactivation and prolonging the action potential of excitable membranes. ATX II has been used as a powerful activator of TTX-sensitive and insensitive sodium channels in various excitable tissue and cell types (at concentration range of 10-100 nM).
Source: E. coli
Species: A. sulcata
Molecular Mass: ~4935 Da
AA Sequence: GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ
Purity: ≥98%
Stability: ~2 years at -20 centigrade. Upon reconstitution, store solutions in working aliquots at -20 centigrade. When stored properly, the solutions are stable for at least three months.
Storage: Store at -20 centigrade
Reconstitution: Reconstitute with distilled water or any aqueous buffer. Dissolving 50μg in 1.01 mL of any conventional buffer gives a stock solution of 10μM.
Synonyms: ATX II

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.