"LMP1" Related Products

Recombinant Epstein-Barr virus LMP1 protein, His-tagged

Cat.No.: LMP1-01E
Product Overview: Recombinant Human Epstein-Barr virus LMP1(185-366aa) with His tag was expressed in Yeast.
Source: Yeast
Species: Epstein-Barr virus
Tag : His
Form: Tris-based buffer, 50% glycerol
AA Sequence: YFHGPRHTDEHHHDDSLPHPQQATDDSSHESDSNSNEGRHHLLVSGAGDGPPLCSQNLGA PGGGPDNGPQDPDNTDDNGPQDPDNTDDNGNTDDNGPQDPDNTDDNGPHDPLPHNPSDSA GNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD
Purity: >85% (SDS-PAGE)
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage: Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade.
Gene Name: LMP1 LMP1 [ Human herpesvirus 4 ]
Official Symbol: LMP1
Synonyms: LMP1; Latent membrane protein 1
Gene ID: 3783750
MIM: P03230

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.