"SNX-482" Related Products

Recombinant H. gigas SNX-482

Cat.No.: SNX482-253H
Product Overview: Recombinant H. gigas SNX-482 was expressed in E. coli.
Description: SNX-482 is a peptidyl toxin originally isolated from the venom of the spider Hysterocrates gigas. SNX-482 specifically blocks Cav2.3 (a1E, R-type) calcium channels in a voltage dependent manner. SNX-482 also blocks P/Q-type voltage-gated Ca2+ channels and blocks A-type K+ channels (IC50 of <3 nm).
Source: E. coli
Species: H. gigas
Molecular Mass: 4495.00
AA Sequence: GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD
Purity: ≥98% (HPLC)
Storage: Store at -20 centigrade
Reconstitution: Any aqueous buffer. Centrifuge before use (10000 x g for 5 min). After reconstitution, store for 3 months at -20 centigrade or up to four weeks at 2-8 centigrade.
Synonyms: SNX-482; SNX

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.