"HIVP14" Related Products


Recombinant HIV HIVP14 protein, β-gal-tagged

Cat.No.: HIVP14-181H
Product Overview: The E.coli derived 39kDa recombinant protein is a non-glycosylated polypeptide chain, containing the HIV-1 p24 gag immunodominant regions, 77-436 amino acids. The HIV-1 p24 gag is fused to beta-galactosidase (114kDa).
Description: Human immunodeficiency virus (HIV) is a retrovirusthat can lead to a condition in which the immune systembegins to fail, leading to opportunistic infections. HIV primarily infects vital cells in the humanimmune systemsuch as helper T cells(specifically CD4+ T cells), macrophagesand dendritic cells. HIV infection leads to low levels of CD4+ T cells through three main mechanisms: firstly, direct viral killing of infected cells; secondly, increased rates of apoptosisin infected cells; and thirdly, killing of infected CD4+ T cells by CD8 cytotoxic lymphocytesthat recognize infected cells. When CD4+ T cell numbers decline below a critical level, cell-mediated immunityis lost, and the body becomes progressively more susceptible to opportunistic infections. HIV was classified as a member of the genus Lentivirus, part of the family of Retroviridae. Lentiviruses have many common morphologies and biological properties. Many species are infected by lentiviruses, which are characteristically responsible for long-duration illnesses with a long incubation period. Lentiviruses are transmitted as single-stranded, positive-sense, enveloped RNA viruses. Upon entry of the target cell, the viral RNA genomeis converted to double-stranded DNAby a virally encoded reverse transcriptasethat is present in the virus particle. This viral DNA is then integrated into the cellular DNA by a virally encoded integraseso that the genome can be transcribed. Once the virus has infected the cell, two pathways are possible: either the virus becomes latentand the infected cell continues to function, or the virus becomes active and replicates, and a large number of virus particles are liberated that can then infect other cells.
Source: E. coli
Species: HIV
Tag : β-gal
Form: Sterile filtered colorless clear solution. 8M urea, 20mM Tris-HCl pH-8 & 10mM b-mercaptoethanol.
Molecular Mass: 39kDa
Protein length: 77-436 amino acids
AA sequence: slyntvatlycvhqrieikdtkealdkikeeqnkskkkaqqaaadtghssqvsqnypivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvlaeamsqvtnsatimmqrgnfrnqrkivkcfncgkeghiarncraprkkgcwkcgkeghqmkdcterqanflgk.
Purity: Greater than 95.0% as determined by HPLC analysis and SDS-PAGE.
Applications: HIV-1 p24 gag antigen in ELISA and Western blots, excellent antigen for early detection of HIV seroconvertors with minimal specificity problems.
Usage: The products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Stability: HIV-1 p24 gag although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Specificity: Immunoreactive with all sera of HIV-1 infected individuals.
Shipping: Ice Packs

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.