"tat" Related Products

Expand
Expand
Expand

Recombinant HIV tat protein

Cat.No.: tat-189H
Product Overview: HIV-1 TAT Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 86 amino acids encoded by two exons and having chain having a molecular mass of 14kDa.
Description: Human immunodeficiency virus type-1 (HIV-1) regulatory Tat protein plays an essential role in viral replication (Jones KA, 1994) and infectivity (Arya SK, 1985; Fisher AG, 1986). In addition, during acute infection, Tat is released extracellularly by infected cells (Chang HC, 1997; Ensoli B, 1990) and is taken up by neighboring cells where it transactivates viral replication (Ensoli B, 1993) and increases virus infectivity.
HIV-1 Tat activates transcription of HIV-1 viral genes by inducing phosphorylation of the C-terminal domain (CTD) of RNA polymerase II (RNAPII). Tat can also disturb cellular metabolism by inhibiting proliferation of antigen-specific T lymphocytes and by inducing cellular apoptosis. Tat-induced apoptosis of T-cells is attributed, in part, to the distortion of microtubules polymerization. LIS1 is a microtubule-associated protein that facilitates microtubule polymerization.
Source: E. coli
Species: HIV
Form: Sterile Filtered and lyophilized, though might appear as a solution as a result of the glycerol content. Lyophilized with 0.1% glycerol.
Molecular Mass: 14kDa
Protein length: 86 amino acids
AA sequence: MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRPPQGSQTHQVSLSKQPTSQSRGDPTGPKE.
Purity: Greater than 90.0% as determined by SDS-PAGE.
Usage: The products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Stability: Lyophilized HIV-1 TAT although stable at room temperature for 1 week, should be stored desiccated below -18°C. Upon reconstitution HIV-1 TAT should be stored at 4°C between 2-7 days and for future use below -18°C. For long-term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Specificity: Immunoreactive with all sera of HIV-1 infected individuals.
Solubility: It is recommended to reconstitute the lyophilized HIV-1 TAT in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Gene Name: tat p14 [ Human immunodeficiency virus 1 ]
Official Symbol: tat
Synonyms: tat; p14
Gene ID: 155871
Protein Refseq: NP_057853.1
UniProt ID: P04608

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.