Recombinant Human CCR2 Protein, GST-Tagged

• Cat.No.: CCR2-0689H
• Product Overview: Human CCR2 partial ORF (NP_000639, 1 a.a. - 42 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. This gene is located in the chemokine receptor gene cluster region. Two alternatively spliced transcript variants are expressed by the gene. [provided by RefSeq, Mar 2009]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 30.36 kDa
• AA Sequence: MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCR2 chemokine (C-C motif) receptor 2 [ Homo sapiens ]
• Official Symbol: CCR2
• Synonyms: CCR2; chemokine (C-C motif) receptor 2; CMKBR2; CC CKR 2; CD192; CKR2; FLJ78302; MCP 1 R; CCR2A; CCR2B; CKR2A; CKR2B; MCP-1-R; CC-CKR-2
• Gene ID: 729230
• mRNA Refseq: NM_001123041
• Protein Refseq: NP_001116513
• MIM: 601267
• UniProt ID: P41597