"COPS2" Related Products

Expand
Expand
Expand

Recombinant Human COPS2 protein, T7/His-tagged

Cat.No.: COPS2-24H
Product Overview: Recombinant Human COPS2 fused with with a small T7-His Tag (29aa) fusion at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag : T7/His
Form: Sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA
Purity: > 90% by SDS-PAGE.
Applications: 1. May be used for in vitro COPS2 mediated ubiquitin pathway regulation study in COP9 signalosome complex for early stage of neuronal differentiation by intracellular delivery of this protein with ProFectin Reagent.
2. May be used for protein-protein interaction mapping.
3. May be used as specific substrate protein for kinase, ad ubiquitin (Sumo pathway) related enzyme functional screening assays.
4. Potential early diagnostic biomarker protein for gastric cancer.
5. As immunogen for specific antibody production.
Storage: In Liquid. Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Concentration: 0.5 mg/ml
Gene Name: COPS2 COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis) [ Homo sapiens ]
Official Symbol: COPS2
Synonyms: COPS2; COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis); COP9 signalosome complex subunit 2; ALIEN; CSN2; TRIP15; TRIP-15; alien homolog; signalosome subunit 2; TR-interacting protein 15; JAB1-containing signalosome subunit 2; thyroid receptor interacting protein 15; thyroid receptor-interacting protein 15; SGN2;
Gene ID: 9318
mRNA Refseq: NM_004236
Protein Refseq: NP_004227
MIM: 604508
UniProt ID: P61201
Chromosome Location: 15q21.2
Function: protein binding; signal transducer activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.