Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human HTR1A protein, GST-tagged

Cat.No. : HTR1A-27H
Product Overview : Recombinant Human HTR1A(1 a.a. - 36 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a G protein-coupled receptor for 5-hydroxytryptamine (serotonin), and belongs to the 5-hydroxytryptamine receptor subfamily. Serotonin has been implicated in a number of physiologic processes and pathologic conditions. Inactivation of this gene in mice results in behavior consistent with an increased anxiety and stress response. Mutation in the promoter of this gene has been associated with menstrual cycle-dependent periodic fevers.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 29.7 kDa
AA Sequence : MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQ
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : HTR1A 5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled [ Homo sapiens ]
Official Symbol : HTR1A
Synonyms : HTR1A; 5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 1A , ADRB2RL1, ADRBRL1; 5-hydroxytryptamine receptor 1A; 5 HT1A; 5-HT1a receptor; serotonin receptor 1A; G protein coupled receptor; guanine nucleotide-binding regulatory protein-coupled receptor; G-21; 5HT1a; 5-HT1A; 5-HT-1A; ADRBRL1; ADRB2RL1;
Gene ID : 3350
mRNA Refseq : NM_000524
Protein Refseq : NP_000515
MIM : 109760
UniProt ID : P08908
Chromosome Location : 5q11.2-q13
Pathway : Amine ligand-binding receptors, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem; Monoamine GPCRs, organism-specific biosystem;
Function : G-protein coupled receptor activity; drug binding; receptor activity; serotonin binding; serotonin receptor activity; signal transducer activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends