"IL28RA" Related Products

Expand

Recombinant Human IL28RA protein, GST-tagged

Cat.No.: IL28RA-49H
Product Overview: Recombinant Human IL28RA(28-222aa) fused with GST tag was expressed in E. coli.
Description: The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.
Source: E. coli
Species: Human
Tag : GST
Form: Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0) and 10% glycerol.
AA Sequence: QNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEV
Storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name: IL28RA interleukin 28 receptor, alpha (interferon, lambda receptor) [ Homo sapiens ]
Official Symbol: IL28RA
Synonyms: IL28RA; interleukin 28 receptor, alpha (interferon, lambda receptor); interleukin 28 receptor, alpha; interleukin-28 receptor subunit alpha; CRF2/12; IFNLR; IL 28R1; interferon lambda receptor 1; CRF2-12; IL-28RA; IL-28R-alpha; IFN-lambda-R1; IFN-lambda receptor 1; interleukin 28 receptor A; IL-28 receptor subunit alpha; interferon lambda, receptor 1; interleukin 28 alpha receptor; class II cytokine receptor CRF2/12; interleukin or cytokine receptor 2; cytokine receptor class-II member 12; cytokine receptor family 2 member 12; likely interleukin or cytokine receptor 2; LICR2; IFNLR1; IL-28R1;
Gene ID: 163702
mRNA Refseq: NM_170743
Protein Refseq: NP_734464
MIM: 607404
UniProt ID: Q8IU57
Chromosome Location: 1p36.11
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem;
Function: contributes_to cytokine receptor activity; protein binding; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.