"MTA2" Related Products

Expand

Recombinant Human MTA2 protein, GST-tagged

Cat.No.: MTA2-26H
Product Overview: Recombinant Human MTA2(521 a.a. - 620 a.a.) fused with GSTtag at N-terminal was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag : GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.74 kDa
AA Sequence: VKDLVAQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKAL
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: MTA2 metastasis associated 1 family, member 2 [ Homo sapiens ]
Official Symbol: MTA2
Synonyms: MTA2; metastasis associated 1 family, member 2; metastasis associated gene family, member 2 , MTA1L1; metastasis-associated protein MTA2; MTA1 L1; MTA1-L1 protein; metastasis-associated 1-like 1; metastasis-associated protein 2; metastasis -associated gene 1-like 1; p53 target protein in deacetylase complex; metastasis associated gene family, member 2; PID; MTA1L1; DKFZp686F2281;
Gene ID: 9219
mRNA Refseq: NM_004739
Protein Refseq: NP_004730
MIM: 603947
UniProt ID: O94776

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.