"SENP2" Related Products

Expand
Expand

Recombinant Human SENP2 protein

Cat.No.: SENP2-32H
Product Overview: Recombinant Human SENP2(Asp363-Leu589) was expressed in E. coli.
Description: SENP2 is an enzyme that belongs to the peptidase C48 family. SENP2 is a protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SUMO1, SUMO2 and SUMO3 to their mature forms and deconjugation of SUMO1, SUMO2 and SUMO3 from targeted proteins. SUMO1 is a small ubiquitin-like protein that can be covalently conjugated to other proteins. It has been implicated as a down-regulator of CTNNB1 levels and may therefore be a modulator of the Wnt pathway.
Source: E. coli
Species: Human
Form: Supplied as a 0.2 μm filtered solution of 50mM HEPES,5% Glycerol, pH 7.4.
AA Sequence: DDLLELTEDMEKEISNALGHGPQDEILSSAFKLRITRGDIQTLKNYHWLNDEVINFYMNLLVERN KKQGYPALHVFSTFFYPKLKSGGYQAVKRWTKGVNLFEQEIILVPIHRKVHWSLVVIDLRKKCLK YLDSMGQKGHRICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFTCKYAD YISRDKPITFTQHQMPLFRKKMVWEILHQQLL
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Storage: Store at < -20 centigrade, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Gene Name: SENP2 SUMO1/sentrin/SMT3 specific peptidase 2 [ Homo sapiens ]
Official Symbol: SENP2
Synonyms: SENP2; SUMO1/sentrin/SMT3 specific peptidase 2; SUMO1/sentrin/SMT3 specific protease 2; sentrin-specific protease 2; AXAM2; DKFZp762A2316; KIAA1331; SMT3IP2; SMT3-specific isopeptidase 2; sentrin/SUMO-specific protease SENP2;
Gene ID: 59343
mRNA Refseq: NM_021627
Protein Refseq: NP_067640
MIM: 608261
UniProt ID: Q9HC62
Chromosome Location: 3q28
Pathway: Nuclear pore complex, organism-specific biosystem; RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; Wnt Signaling Pathway NetPath, organism-specific biosystem; Wnt signaling pathway, organism-specific biosystem; Wnt signaling pathway, conserved biosystem;
Function: SUMO-specific protease activity; cysteine-type peptidase activity; peptidase activity; protein binding; protein domain specific binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.