"UCMA" Related Products

Expand

Recombinant Human UCMA protein

Cat.No.: UCMA-22H
Product Overview: Recombinant Human UCMA(Ser65-Thr138) was expressed in E. coli.
Description: C10orf49 is a secreted protein which encoded by the UCMA gene. It is a member of the UCMA family. C10orf49 is predominantly expressed in resting chondrocytes. It may be involved in the negative control of osteogenic differentiation of osteochondrogenic precursor cells in peripheral zones of fetal cartilage and at the cartilage-bone interface.
Source: E. coli
Species: Human
Form: Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
AA Sequence: GHMSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDG LHPSYLYNRHHT
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Storage: Store at < -20 centigrade, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Gene Name: UCMA upper zone of growth plate and cartilage matrix associated [ Homo sapiens ]
Official Symbol: UCMA
Synonyms: UCMA; upper zone of growth plate and cartilage matrix associated; C10orf49, chromosome 10 open reading frame 49; unique cartilage matrix-associated protein; Gla-rich protein; GRP; C10orf49;
Gene ID: 221044
mRNA Refseq: NM_145314
Protein Refseq: NP_660357
UniProt ID: Q8WVF2
Chromosome Location: 10p13

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.