"Maurotoxin" Related Products

Recombinant Scorpio Maurus palmatus Maurotoxin

Cat.No.: MTX-143S
Product Overview: Recombinant Maurotoxin was expressed in and extracted from E. coli and purified to homogeneity.
Description: Maurotoxin is a 34 amino acid recombinant toxin, originally isolated from the venom of the scorpion Scorpio Maurus palmatus; a member of the α-KTx6.2 scorpion toxin family. It blocks voltage-gated potassium channels (KV1.1/KCNA1, KV1.2/KCNA2, and KV1.3/KCNA3) and inhibits apamin-sensitive small conductance calcium-activated channels (SK channels), particularly KCa3.1(IKca1, SK4).
Source: E. coli
Species: Scorpio Maurus palmatus
Bio-activity: Maurotoxin is a 34 amino acid recombinant toxin, originally isolated from the venom of the scorpion Scorpio Maurus palmatus; a member of the α-KTx6.2 scorpion toxin family. It blocks voltage-gated potassium channels.
Molecular Mass: 3613 Da
AA Sequence: VSCTGSKDCYAPCRKQTGCPNAKCINKSCKCYGC
Purity: ≥95% (HPLC)
Storage: Store at -20 centigrade
Reconstitution: Stock solution of 1μm can be obtained by adding 0.277 mL of any conventional buffer perμg of protein.
Synonyms: MTX scorpion toxin; MTX
Products Types

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.