"OD1" Related Products

Synthetic OD1

Cat.No.: TOXPP-533S
Product Overview: This product is a potent Nav1.7 channel activator with the formula of C308H466N90O95S8.
Description: OD1 is a scorpion peptide that has been isolated initially from the venom of the scorpion Odonthobuthus doriae. OD1 potently inhibits fast inactivation of mammalian channels Nav1.7 (EC50 4.5 nM), Nav1.4 (EC5010 ± 2 nM) and Nav1.6 (EC5047 ± 10 nM). OD1 also blocks fast inactivation of the para/tipE insect channel (EC5080 nM). OD1 weakly affects mammalian Nav1.3 and Nav1.5 (EC50> 1 μM) and does not affect Nav1.2 and Nav1.8.OD1 induces spontaneous pain when injected in animal in association with our without Veratridine and can be used to test the analgesic effects of Nav1.7 blockersin-vivo.
Source: Synthetic
Species: Synthetic
Form: White lyophilized solid
Molecular Mass: 7206.20 Da
Protein length: 65
AA Sequence: AA sequence: GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR-NH2
Disulfide Bonds: C13-C64; C17-C37; C23-C47; C27-C49
Purity: >95%

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.