"FLT3" Related Products

Recombinant Rhesus FLT3 protein

Cat.No. : FLT3-1154R
Product Overview : Recombinant Rhesus FLT3 protein was expressed in Escherichia coli.
Description : Flt-3 ligand (FL) is a recently identified hematopoietic cytokine whose activities are mediated by binding to the transmembrane glycoprotein Flt-3. Flt-3 was first discovered as a member of the class III subfamily of receptor tyrosine kinases (RTK) whose expression among hematopoietic cells was found to be restricted to highly enriched stem/progenitor cell populations. Additionally, class III RTKs include the receptors from SCF, M-CSF and PDGF. Not surprisingly, Flt-3 ligand is also structurally related to M-CSF and SCF. All three cytokines have been shown to exist both as type I transmembrane proteins and as soluble proteins. The predominant human FL isoform is a transmembrane protein that can undergo proteolytic cleavage to generate a soluble form of the protein. FL has been shown to synergize with a wide variety of hematopoietic cytokines to stimulate the growth and differentiation of early hematopoietic progenitors.
Source : E.coli
Species : Rhesus
Form : Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human AML5 cells is less than 1.0 ng/ml, corresponding to a specific activity of > 1.0 × 10⁶ IU/mg.
Molecular Mass : Approximately 18.0 kDa, a single non-glycosylated polypeptide chain containing 159 amino acids.
Protein length : 159
AA Sequence : TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVPSNLQDEELCGALWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQHPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPRSPGALEATALTAPQRP
Endotoxin : Less than 1 EU/μg of rRhFlt-3L as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
SDS-PAGE of FLT3-1154R :

Gene Name : FLT3
Official Symbol : FLT3
Synonyms : Flt3L, SL cytokine
Gene ID : 719239
mRNA Refseq : XM_028837449.1
Protein Refseq : XP_028693282.1
UniProt ID : H9Z6V7

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.