Cat.No. : |
TNFRSF1B-5270H |
Product Overview : |
Recombinant Human TNFRSF1B protein was expressed in Escherichia coli. |
Description : |
The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. The function of IAPs in TNF-receptor signalling is unknown, however, c-IAP1 is thought to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways. |
Source : |
E.coli |
Species : |
Human |
Form : |
Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4. |
Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the TNF-α mediated cytotoxicity in the L-929 cells is less than 0.2 μg/ml, corresponding to a specific activity of > 5000 IU/mg in the presence of 0.25 ng/mL of rHuTNF-α. |
Molecular Mass : |
Approximately 20.0 kDa, a single non-glycosylated polypeptide chain containing 184 amino acids. |
Protein length : |
184 |
AA Sequence : |
MPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT |
Endotoxin : |
Less than 0.1 EU/µg of rHusTNF RII/TNFRSF1B as determined by LAL method. |
Purity : |
>97% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |