"PBK" Related Products

Expand
Expand

Recombinant Human PDZ Binding Kinase, His-tagged

Cat. No.: PBK-1931H
Product Overview: Recombinant human PBK protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventionalchromatography techniques.
Description: PBK is aserine/threonine kinase related to the dual specific mitogen-activatedprotein kinase (MAPKK) family. PBK is abundant in placenta and absent fromadult brain tissue. A PDZ domain in the tumor suppressor protein Dlg cancoordinate with the T/SXV motif of PBK. This protein may be involved in theactivation of lymphoid cells and support testicular functions, with asuggested role in the process of spermatogenesis.
Form: Liquid.In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol, 0.1M NaCl.
Molecular Weight: 38.6 kDa(346aa) confirmed by MALDI-TOF
Purity: > 95%by SDS-PAGE
Concentration: 1 mg/ml(determined by Bradford assay)
Sequences of aminoacids: MGSSHHHHHHSSGLVPRGSH MGSHMEGISN FKTPSKLSEK KKSVLCSTPT INIPASPFMQ KLGFGTGVNVYLMKRSPRGL SHSPWAVKKI NPICNDHYRS VYQKRLMDEA KILKSLHHPNIVGYRAFTEA NDGSLCLAME YGGEKSLNDL IEERYKASQD PFPAAIILKV ALNMARGLKY LHQEKKLLHGDIKSSNVVIK GDFETIKICD VGVSLPLDEN MTVTDPEACY IGTEPWKPKE AVEENGVITD KADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDF DDEAYYAALG TRPPINMEEL DESYQKVIEL FSVCTNEDPK DRPSAAHIVE ALETDV
Storage: Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoidrepeated freezing and thawing cycles.
Gene Name: PBK PDZ binding kinase [ Homosapiens ]
Official Symbol: PBK
Synonyms: PBK; PDZ binding kinase; SPK;CT84; TOPK; Nori-3; FLJ14385; PDZ-binding kinase; cancer/testis antigen 84;MAPKK-like protein kinase; serine/threonine protein kinase; T-LAKcell-originated protein kinase; spermatogenesis-related protein kinase; EC2.7.12.2; Lymphokine-activated killer T-cell-originated protein kinase
Gene ID: 55872
mRNA Refseq: NM_018492
Protein Refseq: NP_060962
MIM: 611210
UniProt ID: Q96KB5
Chromosome Location: 8p21.2
Function: ATP binding;nucleotide binding; protein binding; protein serine/threonine kinase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.