"PBK" Related Products

Expand
Expand

Recombinant Human PDZ Binding Kinase, His-tagged

Cat. No.: PBK-1931H
Product Overview: Recombinant human PBK protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventionalchromatography techniques.
Description: PBK is aserine/threonine kinase related to the dual specific mitogen-activatedprotein kinase (MAPKK) family. PBK is abundant in placenta and absent fromadult brain tissue. A PDZ domain in the tumor suppressor protein Dlg cancoordinate with the T/SXV motif of PBK. This protein may be involved in theactivation of lymphoid cells and support testicular functions, with asuggested role in the process of spermatogenesis.
Form: Liquid.In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol, 0.1M NaCl.
Molecular Weight: 38.6 kDa(346aa) confirmed by MALDI-TOF
Purity: > 95%by SDS-PAGE
Concentration: 1 mg/ml(determined by Bradford assay)
Sequences of aminoacids: MGSSHHHHHHSSGLVPRGSH MGSHMEGISN FKTPSKLSEK KKSVLCSTPT INIPASPFMQ KLGFGTGVNVYLMKRSPRGL SHSPWAVKKI NPICNDHYRS VYQKRLMDEA KILKSLHHPNIVGYRAFTEA NDGSLCLAME YGGEKSLNDL IEERYKASQD PFPAAIILKV ALNMARGLKY LHQEKKLLHGDIKSSNVVIK GDFETIKICD VGVSLPLDEN MTVTDPEACY IGTEPWKPKE AVEENGVITD KADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDF DDEAYYAALG TRPPINMEEL DESYQKVIEL FSVCTNEDPK DRPSAAHIVE ALETDV
Storage: Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoidrepeated freezing and thawing cycles.
Gene Name: PBK PDZ binding kinase [ Homosapiens ]
Official Symbol: PBK
Synonyms: PBK; PDZ binding kinase; SPK;CT84; TOPK; Nori-3; FLJ14385; PDZ-binding kinase; cancer/testis antigen 84;MAPKK-like protein kinase; serine/threonine protein kinase; T-LAKcell-originated protein kinase; spermatogenesis-related protein kinase; EC2.7.12.2; Lymphokine-activated killer T-cell-originated protein kinase
Gene ID: 55872
mRNA Refseq: NM_018492
Protein Refseq: NP_060962
MIM: 611210
UniProt ID: Q96KB5
Chromosome Location: 8p21.2
Function: ATP binding;nucleotide binding; protein binding; protein serine/threonine kinase activity

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.