"HPGDS" Related Products

Expand
Expand

Recombinant Human Hematopoietic Prostaglandin D Synthase, His-tagged

Cat. No.: HPGDS-2402H
Product Overview: Recombinant humanHPGDS protein, fused to His-tag at N-terminus, was expressed in E.coli andpurified by using conventional chromatography techniques.
Description: HPGDS, also known asGSTS, is a sigma class glutathione-S-transferase family member. The enzymecatalyzes the conversion of PGH2 to PGD2 and plays a role in the productionof prostanoids in the immune system and mast cells. The presence of thisenzyme can be used to identify the differentiation stage of humanmegakaryocytes
Form: Liquid. 20mMTris-HCl buffer (pH8.0) containing 10% glycerol 0.15M NaCl,1mM DTT
Molecular Weight: 25.9 kDa (223aa),confirmed by MALDI-TOF
Purity: > 95% by SDS -PAGE
Concentration: 1 mg/ml (determinedby Bradford assay)
Sequences of aminoacids: MGSSHHHHHHSSGLVPRGSH MGSHMPNYKL TYFNMRGRAE IIRYIFAYLD IQYEDHRIEQ ADWPEIKSTL PFGKIPILEVDGLTLHQSLAIARYLTKNTD LAGNTEMEQC HVDAIVDTLD DFMSCFPWAE KKQDVKEQMF NELLTYNAPHLMQDLDTYLG GREWLIGNSV TWADFYWEIC STTLLVFKPD LLDNHPRLVT LRKKVQAIPA VANWIKRRPQTKL
Storage: Can be stored at+4°C short term (1-2 weeks). For long term storage, aliquot and store at-20°C or -70°C. Avoid repeated freezing and thawing cycles
Gene Name: HPGDShematopoietic prostaglandin D synthase [ Homo sapiens ]
Official Symbol: HPGDS
Synonyms: HPGDS; hematopoietic prostaglandinD synthase; glutathione S transferase sigma; GSTS; H PGDS; PGDS
Gene ID: 27306
mRNA Refseq: NM_014485
Protein Refseq: NP_055300
MIM: 602598
Uniprot ID: O60760
Chromosome Location: 4q22.2
Pathway: Arachidonic acid metabolism,organism-specific biosystem; Arachidonic acid metabolism, conservedbiosystem; Metabolic pathways, organism-specific biosystem
Function: calcium ion binding; glutathionetransferase activity; isomerase activity; magnesium ion binding;prostaglandin-D synthase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.