"HPGDS" Related Products

Expand
Expand

Recombinant Human Hematopoietic Prostaglandin D Synthase, His-tagged

Cat. No.: HPGDS-2402H
Product Overview: Recombinant humanHPGDS protein, fused to His-tag at N-terminus, was expressed in E.coli andpurified by using conventional chromatography techniques.
Description: HPGDS, also known asGSTS, is a sigma class glutathione-S-transferase family member. The enzymecatalyzes the conversion of PGH2 to PGD2 and plays a role in the productionof prostanoids in the immune system and mast cells. The presence of thisenzyme can be used to identify the differentiation stage of humanmegakaryocytes
Form: Liquid. 20mMTris-HCl buffer (pH8.0) containing 10% glycerol 0.15M NaCl,1mM DTT
Molecular Weight: 25.9 kDa (223aa),confirmed by MALDI-TOF
Purity: > 95% by SDS -PAGE
Concentration: 1 mg/ml (determinedby Bradford assay)
Sequences of aminoacids: MGSSHHHHHHSSGLVPRGSH MGSHMPNYKL TYFNMRGRAE IIRYIFAYLD IQYEDHRIEQ ADWPEIKSTL PFGKIPILEVDGLTLHQSLAIARYLTKNTD LAGNTEMEQC HVDAIVDTLD DFMSCFPWAE KKQDVKEQMF NELLTYNAPHLMQDLDTYLG GREWLIGNSV TWADFYWEIC STTLLVFKPD LLDNHPRLVT LRKKVQAIPA VANWIKRRPQTKL
Storage: Can be stored at+4°C short term (1-2 weeks). For long term storage, aliquot and store at-20°C or -70°C. Avoid repeated freezing and thawing cycles
Gene Name: HPGDShematopoietic prostaglandin D synthase [ Homo sapiens ]
Official Symbol: HPGDS
Synonyms: HPGDS; hematopoietic prostaglandinD synthase; glutathione S transferase sigma; GSTS; H PGDS; PGDS
Gene ID: 27306
mRNA Refseq: NM_014485
Protein Refseq: NP_055300
MIM: 602598
Uniprot ID: O60760
Chromosome Location: 4q22.2
Pathway: Arachidonic acid metabolism,organism-specific biosystem; Arachidonic acid metabolism, conservedbiosystem; Metabolic pathways, organism-specific biosystem
Function: calcium ion binding; glutathionetransferase activity; isomerase activity; magnesium ion binding;prostaglandin-D synthase activity

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.