"KHDRBS1" Related Products

Expand
Expand
Expand

Recombinant Human KH domain containing, RNA binding, signal transduction associated 1, GST-tag

Cat. No.: KHDRBS1-2877H
Product Overview: Recombinant human KHDRBS1 (AAH00717, 176 a.a. - 275 a.a.) protein, fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system.
Description: KH domain-containing, RNA-binding, signal transduction-associated protein 1 is a protein that in humans is encoded by the KHDRBS1 gene.
Source: wheat germ
Species: Human
Purification: Glutathione Sepharose 4 Fast Flow
Sequence: ILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLN
Molecular Mass: 36.63 kDa
Note: Best use within three months from the date of receipt of this protein.
Applications: ELISA; WB; Antibody Production; Protein Array
Storage Buffer: Liquid with 50 mM Tris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OfficialSymbol: KHDRBS1
Gene Name: KHDRBS1 KH domain containing, RNA binding, signal transduction associated 1 [ Homo sapiens ]
Synonyms: KHDRBS1; KH domain containing, RNA binding, signal transduction associated 1; p62; p68; Sam68; FLJ34027; src-associated in mitosis 68 kDa protein; p21 Ras GTPase-activating protein-associated p62; GAP-associated tyrosine phosphoprotein p62 (Sam68); KH domain containing, RNA binding, signal transduction; associated 1; KH domain-containing, RNA-binding, signal transduction-associated protein 1; SAM68; GAP-associated tyrosine phosphoprotein p62
Gene ID: 10657
mRNA Refseq: NM_006559
Protein Refseq: NP_006550
MIM: 602489
UniProt ID: Q07666
Chromosome Location: 1p32
Pathway: T Cell Receptor Signaling Pathway
Function: DNA binding; RNA binding; SH3 domain binding; SH3/SH2 adaptor activity; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.