"NGF" Related Products

Expand
Expand

Recombinant Human NGF protein

Cat.No.: NGF-588H
Product Overview: Recombinant Human NGF(Ser122-Arg239) was expressed in HEK293.
Source: HEK293
Species: Human
Form: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 250mM NaCl, pH 7.0
Protein length: Ser122-Arg239
AA Sequence: SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKH WNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Gene Name: NGF nerve growth factor (beta polypeptide) [ Homo sapiens ]
Official Symbol: NGF
Synonyms: NGF; nerve growth factor (beta polypeptide); NGFB; beta-nerve growth factor; nerve growth factor, beta subunit; HSAN5; Beta-NGF; MGC161426; MGC161428;
Gene ID: 4803
mRNA Refseq: NM_002506
Protein Refseq: NP_002497
MIM: 162030
UniProt ID: P01138
Chromosome Location: 1p13.1
Pathway: ARMS-mediated activation, organism-specific biosystem; Activation of TRKA receptors, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Axonal growth stimulation, organism-specific biosystem; Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem; Ceramide signalling, organism-specific biosystem;
Function: growth factor activity; nerve growth factor receptor binding; receptor signaling protein activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.