"IFNA1" Related Products

Expand
Expand

Recombinant Human IFNA1 protein

Cat.No. : IFNA1-06H
Product Overview : Recombinant Human IFNA1 alpha 1a protein was expressed in Escherichia coli.
Description : IFN-αs are proteins secreted by leukocyte. They are mainly involved in innate immune response against viral infection. The IFN-α family has 13 subtypes and 23 different variants. The individual proteins have molecular masses between 19-26 kDa and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN-α subtypes possess a common conserved sequence region between amino acid positions 115-151 while the amino-terminal ends are variable. Many IFN-alpha subtypes differ in their sequences at only one or two positions. Naturally occurring variants also include proteins truncated by 10 amino acids at the carboxy-terminal end.
Source : E.coli
Species : Human
Form : Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4, containing 3 % Mannitol, 5 % Trehalose, 0.05 % Tween-80.
Bio-activity : Fully biologically active when compared to standard. The specific activity determined by an anti-viral assay is no less than 1.0 × 108 IU/mg.
Molecular Mass : Approximately 19.5 kDa, a single non-glycosylated polypeptide chain containing 167 amino acids.
Protein length : 167
AA Sequence : MCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE
Endotoxin : Less than 0.1 EU/µg of rHuIFN-α1a as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : IFNA1
Official Symbol : IFNA1
Synonyms : IFNA1; interferon, alpha 1; interferon alpha-1/13; IFL; IFN; IFN ALPHA; IFN alpha 1b; IFN alphaD; IFNA13; IFNA@; interferon alpha 1b; leIF D; IFN-alpha 1b; IFN-alpha-1/13; interferon-alpha1; interferon alpha-D; IFN-ALPHA; IFN-alphaD; MGC138207; MGC138505; MGC138507;
Gene ID : 3439
mRNA Refseq : NM_024013
Protein Refseq : NP_076918
MIM : 147660
UniProt ID : P01562

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.