"CDH9" Related Products

Recombinant Human CDH9 protein, His-tagged

Cat.No.: CDH9-7751H
Product Overview: Recombinant Human CDH9(Ile22-Ala615) fused with His tag at C-terminal was expressed in HEK293.
Source: HEK293
Species: Human
Tag: His
Form: Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
Protein length: Ile22-Ala615
AA Sequence: ILLQEKPNSYLSSKKIVGLTKDDGKMLRRTKRGWMWNQFFLLEEYTGTDTQYVGKLHTDQDKGDGNLKYILTGDG AGSLFVIDENTGDIHAAKKLDREEKSLYILRAKAIDRKTGRQVEPESEFIIKIHDINDNEPKFTKDLYTASVPEM SGVGTSVIQVTATDADDANYGNSAKVVYSILQGQPYFSVDPESGIIKTALPDMSRENREQYQVVIQAKDMGGQMG GLSGTTTVNITLTDVNNNPPRFPQSTYQFNSPESVPLGTHLGRIKANDPDVGENAEMEYSIAEGDGADMFDVITD KDTQEGIITVKQNLDFENQMLYTLRVDASNTHPDPRFLHLGPFKDTAVVKISVEDIDEPPVFTKVSYLIEVDEDV KEGSIIGQVTAYDPDARNNLIKYSVDRHTDMDRIFGIHSENGSIFTLKALDRESSPWHNITVTATEINNPKQSSH IPVFIRILDINDHAPEFAMYYETFVCENAKPGQLIQTVSVMDKDDPPRGHKFFFEPVPEFTLNPNFTIVDNKDNT AGIMTRKDGYSRNKMSTYLLPILIFDNDYPIQSSTGTLTIRVCACDNQGNMQSCTAEALILSAGLSTGAVDHHHH HH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Shipping: The product is shipped at ambient temperature.Upon receipt, store it immediately at the temperature listed below.
Gene Name: CDH9 cadherin 9, type 2 (T1-cadherin) [ Homo sapiens ]
Official Symbol: CDH9
Synonyms: CDH9; cadherin 9, type 2 (T1-cadherin); cadherin-9; T1-cadherin; MGC125386;
Gene ID: 1007
mRNA Refseq: NM_016279
Protein Refseq: NP_057363
MIM: 609974
UniProt ID: Q9ULB4
Chromosome Location: 5p14
Pathway: Adherens junctions interactions, organism-specific biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem;
Function: calcium ion binding; molecular_function;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.