Recombinant Human CDH9 protein, His-tagged CDH9-7751H

Recombinant Human CDH9 protein, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CDH9 protein, His-tagged

Recombinant Human CDH9 protein, His-tagged

CDH9 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CDH9-7751H
Product Overview : Recombinant Human CDH9(Ile22-Ala615) fused with His tag at C-terminal was expressed in HEK293.
Source : HEK293
Species : Human
Tag : His
Form : Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
Protein length : Ile22-Ala615
AA Sequence : ILLQEKPNSYLSSKKIVGLTKDDGKMLRRTKRGWMWNQFFLLEEYTGTDTQYVGKLHTDQDKGDGNLKYILTGDG AGSLFVIDENTGDIHAAKKLDREEKSLYILRAKAIDRKTGRQVEPESEFIIKIHDINDNEPKFTKDLYTASVPEM SGVGTSVIQVTATDADDANYGNSAKVVYSILQGQPYFSVDPESGIIKTALPDMSRENREQYQVVIQAKDMGGQMG GLSGTTTVNITLTDVNNNPPRFPQSTYQFNSPESVPLGTHLGRIKANDPDVGENAEMEYSIAEGDGADMFDVITD KDTQEGIITVKQNLDFENQMLYTLRVDASNTHPDPRFLHLGPFKDTAVVKISVEDIDEPPVFTKVSYLIEVDEDV KEGSIIGQVTAYDPDARNNLIKYSVDRHTDMDRIFGIHSENGSIFTLKALDRESSPWHNITVTATEINNPKQSSH IPVFIRILDINDHAPEFAMYYETFVCENAKPGQLIQTVSVMDKDDPPRGHKFFFEPVPEFTLNPNFTIVDNKDNT AGIMTRKDGYSRNKMSTYLLPILIFDNDYPIQSSTGTLTIRVCACDNQGNMQSCTAEALILSAGLSTGAVDHHHH HH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Shipping : The product is shipped at ambient temperature.Upon receipt, store it immediately at the temperature listed below.
Gene Name : CDH9 cadherin 9, type 2 (T1-cadherin) [ Homo sapiens ]
Official Symbol : CDH9
Synonyms : CDH9; cadherin 9, type 2 (T1-cadherin); cadherin-9; T1-cadherin; MGC125386;
Gene ID : 1007
mRNA Refseq : NM_016279
Protein Refseq : NP_057363
MIM : 609974
UniProt ID : Q9ULB4
Chromosome Location : 5p14
Pathway : Adherens junctions interactions, organism-specific biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem;
Function : calcium ion binding; molecular_function;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy