Recombinant Human TG, GST-tagged
Cat.No. : | TG-8266H |
Product Overview : | Human TG partial ORF ( NP_003226, 2671 a.a. - 2768 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
Description : | Thyroglobulin (Tg) is a glycoprotein homodimer produced predominantly by the thryroid gland. It acts as a substrate for the synthesis of thyroxine and triiodothyronine as well as the storage of the inactive forms of thyroid hormone and iodine. Thyroglobulin is secreted from the endoplasmic reticulum to its site of iodination, and subsequent thyroxine biosynthesis, in the follicular lumen. Mutations in this gene cause thyroid dyshormonogenesis, manifested as goiter, and are associated with moderate to severe congenital hypothyroidism. Polymorphisms in this gene are associated with susceptibility to autoimmune thyroid diseases (AITD) such as Graves disease and Hashimoto thryoiditis. |
Source : | Wheat germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 36.52 kDa |
AA Sequence : | PYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWS KYISSLKTSADGAKGGQSAESEEEE LTAGSGLREDLLSLQEPGSKTYSK |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name : | TG thyroglobulin [ Homo sapiens (human) ] |
Official Symbol : | TG |
Synonyms : | TG; TGN; AITD3; thyroglobulin |
Gene ID : | 7038 |
mRNA Refseq : | NM_003235 |
Protein Refseq : | NP_003226 |
MIM : | 188450 |
UniProt ID : | P01266 |
Chromosome Location : | 8q24 |
Pathway : | Autoimmune thyroid disease; Thyroid hormone synthesis |
Function : | NOT carboxylesterase activity; hormone activity; NOT neurexin family protein binding |
Products Types
◆ Recombinant Protein | ||
TG-9158M | Recombinant Mouse TG Protein, His (Fc)-Avi-tagged | +Inquiry |
TG-2112R | Recombinant Rat TG Protein (21-300 aa), His-SUMO-tagged | +Inquiry |
Tg-2125R | Recombinant Rat Tg Protein, His-tagged | +Inquiry |
Tg-6386M | Recombinant Mouse Tg Protein, Myc/DDK-tagged | +Inquiry |
TG-0056H | Recombinant Human TG Protein | +Inquiry |
◆ Native Protein | ||
TG-37P | Native Porcine TG protein | +Inquiry |
TG-31519TH | Native Human TG | +Inquiry |
TG-22P | Native Porcine Thyroglobulin (TG) Protein | +Inquiry |
◆ Assay kits | ||
Kit-2036 | Triglyceride Colorimetric Assay Kit | +Inquiry |
Kit-2277 | Transglutaminase Inhibitor Screening Assay Kit | +Inquiry |
Kit-0814 | Transglutaminase Activity Colorimetric Assay Kit | +Inquiry |
Kit-0815 | Triglyceride Quantification Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionCustomer Reviews (3)
Write a reviewEnhancing efficiency, the biomolecular reagent yields fast experimental results.
Suitable for long-term storage, the protein substance exhibits long-lasting stability.
Emphasizing product innovation, the manufacturer regularly introduces new protein reagents.
Ask a Question for All TG Products
Required fields are marked with *
My Review for All TG Products
Required fields are marked with *
Inquiry Basket