Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human TG, GST-tagged

Cat.No. : TG-8266H
Product Overview : Human TG partial ORF ( NP_003226, 2671 a.a. - 2768 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
Description : Thyroglobulin (Tg) is a glycoprotein homodimer produced predominantly by the thryroid gland. It acts as a substrate for the synthesis of thyroxine and triiodothyronine as well as the storage of the inactive forms of thyroid hormone and iodine. Thyroglobulin is secreted from the endoplasmic reticulum to its site of iodination, and subsequent thyroxine biosynthesis, in the follicular lumen. Mutations in this gene cause thyroid dyshormonogenesis, manifested as goiter, and are associated with moderate to severe congenital hypothyroidism. Polymorphisms in this gene are associated with susceptibility to autoimmune thyroid diseases (AITD) such as Graves disease and Hashimoto thryoiditis.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 36.52 kDa
AA Sequence : PYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWS KYISSLKTSADGAKGGQSAESEEEE LTAGSGLREDLLSLQEPGSKTYSK
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : TG thyroglobulin [ Homo sapiens (human) ]
Official Symbol : TG
Synonyms : TG; TGN; AITD3; thyroglobulin
Gene ID : 7038
mRNA Refseq : NM_003235
Protein Refseq : NP_003226
MIM : 188450
UniProt ID : P01266
Chromosome Location : 8q24
Pathway : Autoimmune thyroid disease; Thyroid hormone synthesis
Function : NOT carboxylesterase activity; hormone activity; NOT neurexin family protein binding

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (3)

Write a review
Reviews
07/11/2021

    Enhancing efficiency, the biomolecular reagent yields fast experimental results.

    08/08/2019

      Suitable for long-term storage, the protein substance exhibits long-lasting stability.

      03/16/2017

        Emphasizing product innovation, the manufacturer regularly introduces new protein reagents.

        Ask a Question for All TG Products

        Required fields are marked with *

        My Review for All TG Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends