"ENT1" Related Products

Recombinant Human SLC29A1 protein, GST-tagged

Cat.No.: ENT1-12465H
Product Overview: Recombinant Human SLC29A1(150-456 aa) fused with GST tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: GST
Form: 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol.
Molecular Mass: 61 kDa
Protein length: 150-456 aa
AA Sequence: INSFGAILQGSLFGLAGLLPASYTAPIMSGQGLAGFFASVAMICAIASGSELSESAFGYFITACAVIILTIICYL GLPRLEFYRYYQQLKLEGPGEQETKLDLISKGEEPRAGKEESGVSVSNSQPTNESHSIKAILKNISVLAFSVCFI FTITIGMFPAVTVEVKSSIAGSSTWERYFIPVSCFLTFNIFDWLGRSLTAVFMWPGKDSRWLPSLVLARLVFVPL LLLCNIKPRRYLTVVFEHDAWFIFFMAAFAFSNGYLASLCMCFGPKKVKPAEAETAGAIMAFFLCLGLALGAVFS FLFRAIV
Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name: SLC29A1 solute carrier family 29 (nucleoside transporters), member 1 [ Homo sapiens ]
Official Symbol: SLC29A1
Synonyms: SLC29A1; solute carrier family 29 (nucleoside transporters), member 1; ENT1; equilibrative nucleoside transporter 1; nucleoside transporter, es-type; solute carrier family 29 member 1; solute carrier family 29, member 1; equilibrative NBMPR-sensitive nucleoside transporter; equilibrative nitrobenzylmercaptopurine riboside-sensitive nucleoside transporter; equilibrative nitrobenzylmercaptopurine riboside (NBMPR)-sensitive nucleoside transporter; MGC1465; MGC3778;
Gene ID: 2030
mRNA Refseq: NM_001078174
Protein Refseq: NP_001071642
MIM: 602193
UniProt ID: Q99808
Chromosome Location: 6p21.1
Pathway: Fluoropyrimidine Activity, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of nucleosides and free purine and pyrimidine bases across the plasma membrane, organism-specific biosystem; Transport of vitamins, nucleosides, and related molecules, organism-specific biosystem;
Function: nucleoside transmembrane transporter activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.