"NAAA" Related Products

Expand

Recombinant Human NAAA, His-tagged

Cat.No.: NAAA-34H
Product Overview: Recombinant Human N-Acylethanolamine-Hydrolyzing Acid Amidase/NAAA is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser29-Glu199) of Human NAAA fused with a polyhistidine tag at the C-terminus.
Source: HEK293
Species: Human
Tag: His
AA Sequence: SPPAAPRFNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQ PFTGEIRGMCDFMNLSLADCLLVNLAYESSVFCTSIVAQDSRGHIYHGRNLDYPFGNVLRKLTVD VQFLKNGQIAFTGTTFIGYVGLWTGQSPHKFTVSGDERDPEVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name: NAAA N-acylethanolamine acid amidase [ Homo sapiens ]
Official Symbol: NAAA
Synonyms: NAAA; N-acylethanolamine acid amidase; ASAHL, N acylsphingosine amidohydrolase (acid ceramidase) like; N-acylethanolamine-hydrolyzing acid amidase; ASAH-like protein; acid ceramidase-like protein; PLT; ASAHL;
Gene ID: 27163
mRNA Refseq: NM_001042402
Protein Refseq: NP_001035861
MIM: 607469
UniProt ID: Q02083
Chromosome Location: 4q21.1
Function: hydrolase activity; molecular_function; transcription factor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.