"B3GALT2" Related Products

Expand
Expand

Recombinant Human B3GALT2, His-tagged

Cat.No.: B3GALT2-39H
Product Overview: Recombinant Human β-1,3-Galactosyltransferase 2/B3GALT2 is produced by mammalian expression system in human cells. The target protein is expressed with sequence (His46-His422) of Human B3GALT2 fused with a polyhistidine tag at the C-terminus.
Source: HEK293
Species: Human
Tag: His
AA Sequence: HDWLPGRAGFKENPV TYTFRGFRSTKSETNHSSLRNIWKETVPQTLRPQTATNSNNTDLSPQGV TGLENTLSANG SIYNEKGTGHPNSYHFKYIINEPEKCQEKSPFLILLIAAEPGQIEARRAIRQT WGNESLA PGIQITRIFLLGLSIKLNGYLQRAILEESRQYHDIIQQEYLDTYYNLTIKTLMGMNW VAT YCPHIPYVMKTDSDMFVNTEYLINKLLKPDLPPRHNYFTGYLMRGYAPNRNKDSKWYMPP DLYPSERYPVFCSGTGYVFSGDLAEKIFKVSLGIRRLHLEDVYVGICLAKLRIDPVPPPN EFVF NHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNACANAAKEKAGRYRHRK LHVDHHHH HH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name: B3GALT2 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 [ Homo sapiens ]
Official Symbol: B3GALT2
Synonyms: B3GALT2; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2; beta-1,3-galactosyltransferase 2; beta3Gal T2; beta-3-galt2; beta-1,3-GalTase 2; UDP-galactose:2-acetamido-2-deoxy-D-glucose 3beta-galactosyltransferase 2; GLCT2; BETA3GALT2; beta3Gal-T2;
Gene ID: 8707
mRNA Refseq: NM_003783
Protein Refseq: NP_003774
MIM: 603018
UniProt ID: O43825
Chromosome Location: 1q31
Pathway: Glycosphingolipid biosynthesis - lacto and neolacto series, organism-specific biosystem; Glycosphingolipid biosynthesis - lacto and neolacto series, conserved biosystem; Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer, organism-specific biosystem; Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function: UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity; galactosyltransferase activity; transferase activity, transferring glycosyl groups;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.