"CD160" Related Products

Expand
Expand

Recombinant Human CD160, His-tagged

Cat.No.: CD160-56H
Product Overview: Recombinant Human CD160 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ile27-Ser159) of Human CD160 fused with a 6His tag at the C-terminus.
Description: CD160 antigen is a Lipid-anchor that exists as a disulfide-linked homomultimer. CD160 contains one Ig-like V-type domain. The human CD160 precursor is a cysteine-rich, glycosylphosphatidylinositol-anchored protein of 181 amino acids with a single Ig-like domain. It is weakly homologous to KIR2DL4. CD160 is expressed in the spleen, peripheral blood, and small intestine. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. CD160 is a receptor showing broad specificity for both classical and non-classical MHC class I molecules.
Source: HEK293
Species: Human
Tag: His
AA Sequence: INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEI SSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEG TLSVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Gene Name: CD160 CD160 molecule [ Homo sapiens ]
Official Symbol: CD160
Synonyms: CD160; CD160 molecule; CD160 antigen; BY55; NK1; NK28; CD160-delta Ig; CD160 transmembrane isoform; natural killer cell receptor BY55; natural killer cell receptor, immunoglobulin superfamily member; FLJ46513;
Gene ID: 11126
mRNA Refseq: NM_007053
Protein Refseq: NP_008984
MIM: 604463
UniProt ID: O95971
Chromosome Location: 1q21.2
Pathway: Adaptive Immune System, organism-specific biosystem; Immune System, organism-specific biosystem; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell, organism-specific biosystem;
Function: MHC class I receptor activity; receptor activity; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.