| Cat.No.: | EXTL3-83H |
| Product Overview: | Recombinant Human Exostosin-Like 3/EXTL3 is produced by our mammalian expression system. The target protein is expressed with sequence (Thr52-Leu919) of Human EXTL3. |
| Description: | Exostosin-Like 3 (EXTL3) is a single-pass type II membrane protein that belongs to the Glycosyltransferase 47 family. EXTL3 is found in the endoplasmic reticulum. EXTL3 is involved in the biosynthesis of heparan sulfate proteoglycans and Glycan metabolism. Mutations of EXTL proteins are associated with the development of multiple exostoses (benign bone growths) and cancer. |
| Source: | HEK293 |
| Species: | Human |
| Form: | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| AA Sequence: | MTTLDEADEAGKRIFGPRVGNELCEVKHVLDLCRIRESVSEELLQLEAKRQELNSEIAKLNLKIE ACKKSIENAKQDLLQLKNVISQTEHSYKELMAQNQPKLSLPIRLLPEKDDAGLPPPKATRGCRLH NCFDYSRCPLTSGFPVYVYDSDQFVFGSYLDPLVKQAFQATARANVYVTENADIACLYVILVGEM QEPVVLRPAELEKQLYSLPHWRTDGHNHVIINLSRKSDTQNLLYNVSTGRAMVAQSTFYTVQYRP GFDLVVSPLVHAMSEPNFMEIPPQVPVKRKYLFTFQGEKIESLRSSLQEARSFEEEMEGDPPADY DDRIIATLKAVQDSKLDQVLVEFTCKNQPKPSLPTEWALCGEREDRLELLKLSTFALIITPGDPR LVISSGCATRLFEALEVGAVPVVLGEQVQLPYQDMLQWNEAALVVPKPRVTEVHFLLRSLSDSDL LAMRRQGRFLWETYFSTADSIFNTVLAMIRTRIQIPAAPIREEAAAEIPHRSGKAAGTDPNMADN GDLDLGPVETEPPYASPRYLRNFTLTVTDFYRSWNCAPGPFHLFPHTPFDPVLPSEAKFLGSGTG FRPIGGGAGGSGKEFQAALGGNVPREQFTVVMLTYEREEVLMNSLERLNGLPYLNKVVVVWNSPK LPSEDLLWPDIGVPIMVVRTEKNSLNNRFLPWNEIETEAILSIDDDAHLRHDEIMFGFRVWREAR DRIVGFPGRYHAWDIPHQSWLYNSNYSCELSMVLTGAAFFHKYYAYLYSYVMPQAIRDMVDEYIN CEDIAMNFLVSHITRKPPIKVTSRWTFRCPGCPQALSHDDSHFHERHKCINFFVKVYGYMPLLYT QFRVDSVLFKTRLPHDKTKCFKFI |
| Endotoxin: | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity: | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Storage: | Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
| Reconstitution: | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name: | EXTL3 exostoses (multiple)-like 3 [ Homo sapiens ] |
| Official Symbol: | EXTL3 |
| Synonyms: | EXTL3; exostoses (multiple)-like 3; exostosin-like 3; botv; REG receptor; REGR; reg receptor; EXT-related protein 1; multiple exostosis-like protein 3; putative tumor suppressor protein EXTL3; hereditary multiple exostoses gene isolog; glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase; REG; RPR; BOTV; EXTR1; KIAA0519; DKFZp686C2342; |
| Gene ID: | 2137 |
| mRNA Refseq: | NM_001440 |
| Protein Refseq: | NP_001431 |
| MIM: | 605744 |
| UniProt ID: | O43909 |
| Chromosome Location: | 8p22-p12 |
| Pathway: | Activation of Chaperone Genes by XBP1(S), organism-specific biosystem; Activation of Chaperones by IRE1alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Glycosaminoglycan biosynthesis - heparan sulfate, organism-specific biosystem; Glycosaminoglycan biosynthesis - heparan sulfate, conserved biosystem; Glycosaminoglycan biosynthesis, heparan sulfate backbone, organism-specific biosystem; |
| Function: | glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase activity; metal ion binding; transferase activity, transferring hexosyl groups; |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All EXTL3 Products
Download Datasheet