"MGAT2" Related Products

Expand
Expand

Recombinant Human MGAT2, His-tagged

Cat.No.: MGAT2-92H
Product Overview: Recombinant Human Mannoside Acetylglucosaminyltransferase 2/MGAT2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Arg30-Gln447) of Human MGAT2 fused with a 6His tag at the C-terminus.
Description: Mannoside Acetylglucosaminyltransferase 2 (MGAT2) is a single-pass type II membrane protein that contains the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain and a C-terminal catalytic domain. MGAT2 catalyzes an essential step in the conversion of oligo-mannose to complex N-glycans. Defects in MGAT2 are the cause of congenital disorder of glycosylation type 2A.
Source: HEK293
Species: Human
Tag: His
AA Sequence: RQRKNEALAPPLLDAEPARGAGGRGGDHPSVAVGIRRVSNVSAASLVPAVPQPEADNLTLRYRSL VYQLNFDQTLRNVDKAGTWAPRELVLVVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSHDFWSTE INQLIAGVNFCPVLQVFFPFSIQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYRE AKFSQTKHHWWWKLHFVWERVKILRDYAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVL SLGTYSASRSFYGMADKVDVKTWKSTEHNMGLALTRNAYQKLIECTDTFCTYDDYNWDWTLQYLT VSCLPKFWKVLVPQIPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNNNKQYMFPETLTISEKFTV VAISPPRKNGGWGDIRDHELCKSYRRLQLDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by reducing SDS-PAGE.

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.