"LCMT2" Related Products

Expand
Expand

Recombinant Human LCMT2, His-tagged

Cat.No.: LCMT2-125H
Product Overview: Recombinant Human Leucine Carboxyl Methyltransferase 2/LCMT2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Gln686) of Human LCMT2 fused with a polyhistidine tag at the C-terminus.
Source: HEK293
Species: Human
Tag: His
AA Sequence: MGPRSRERRAGAVQNTNDSSALSKRSLAARGYVQDPFAALLVPGAARRAPLIHRGYYVRARAVRH CVRAFLEQIGAPQAALRAQILSLGAGFDSLYFRLKTAGRLARAAVWEVDFPDVARRKAERIGETP ELCALTGPFERGEPASALCFESADYCILGLDLRQLQRVEEALGAAGLDAASPTLLLAEAVLTYLE PESAAALIAWAAQRFPNALFVVYEQMRPQDAFGQFMLQHFRQLNSPLHGLERFPDVEAQRRRFLQ AGWTACGAVDMNEFYHCFLPAEERRRVENIEPFDEFEEWHLKCAHYFILAASRGDTLSHTLVFPS SEAFPRVNPASPSGVFPASVVSSEGQVPNLKRYGHASVFLSPDVILSAGGFGEQEGRHCRVSQFH LLSRDCDSEWKGSQIGSCGTGVQWDGRLYHTMTRLSESRVLVLGGRLSPVSPALGVLQLHFFKSE DNNTEDLKVTITKAGRKDDSTLCCWRHSTTEVSCQNQEYLFVYGGRSVVEPVLSDWHFLHVGTMA WVRIPVEGEVPEARHSHSACTWQGGALIAGGLGASEEPLNSVLFLRPISCGFLWESVDIQPPITP RYSHTAHVLNGKLLLVGGIWIHSSSFPGVTVINLTTGLSSEYQIDTTYVPWPLMLHNHTSILLPE EQQLLLLGGGGNCFSFGTYFNPHTVTLDLSSLSAGQVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name: LCMT2 leucine carboxyl methyltransferase 2 [ Homo sapiens ]
Official Symbol: LCMT2
Synonyms: LCMT2; leucine carboxyl methyltransferase 2; KIAA0547; MGC9534; PPM2; tRNA yW synthesizing protein 4; TYW4; tRNA-yW synthesizing protein 4; tRNA-Wybutosine-synthesizing protein 4; p21WAF1/CIP1 promoter-interacting protein; FLJ51321;
Gene ID: 9836
mRNA Refseq: NM_014793
Protein Refseq: NP_055608
MIM: 611246
UniProt ID: O60294
Chromosome Location: 15q15.3
Function: methyltransferase activity; protein binding; transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.