"MFAP3" Related Products

Expand
Expand
Expand

Recombinant Human MFAP3, His-tagged

Cat.No.: MFAP3-140H
Product Overview: Recombinant Human Microfibril-Associated Glycoprotein 3/MFAP3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ala19-Met147) of Human MFAP3 fused with a polyhistidine tag at the C-terminus.
Source: HEK293
Species: Human
Tag: His
AA Sequence: AFVLEDVDFDQMVSLEANRSSYNASFPSSFELSASSHSDDDVIIAKEGTSVSIECLLTASHYEDV HWHNSKGQQLDGRSRGGKWLVSDNFLNITNVAFDDRGLYTCFVTSPIRASYSVTLRVIFTSGDMV DHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name: MFAP3 microfibrillar-associated protein 3 [ Homo sapiens ]
Official Symbol: MFAP3
Synonyms: MFAP3; microfibrillar-associated protein 3; microfibril-associated glycoprotein 3; DKFZp586F0219;
Gene ID: 4238
mRNA Refseq: NM_001135037
Protein Refseq: NP_001128509
MIM: 600491
UniProt ID: P55082
Chromosome Location: 5q32-q33.2

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.