Recombinant Mouse Ccl17 protein

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Mouse Ccl17 protein

Recombinant Mouse Ccl17 protein

Ccl17 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : Ccl17-622M
Product Overview : Recombinant Mouse Ccl17 protein was expressed in Escherichia coli.
Description : Murine CCL17 also known as TARC, Small-inducible cytokine A17, Thymus and activation-regulated chemokine and SCYA17, is encoded by the CCL17 gene located on the chromosome 8. Among CC chemokine family members, CCL17 has approximately 24 – 29 % amino acid sequence identity with RANTES, MIP-1α, MIP-1β, MCP-1, MCP-2, MCP-3 and I-309. CCL17 is a secreted protein and expressed by thymus cells constitutively and phytohemagglutinin-stimulated peripheral blood mononuclear cells transiently. It signals through the chemokine receptors CCR4 and CCR8 and displays chemotactic activity for T lymphocytes and some other leukocytes. CCL17 play an important role in skin diseases such as atopic dermatitis, bullous pemphigoid and mycosis fungoides.Recombinant CCL17 has been shown to be chemotactic for T cell lines but not monocytes or neutrophils.
Source : E.coli
Species : Mouse
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 1.0-10 ng/ml.
Molecular Mass : Approximately 7.9 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids.
Protein length : 70
AA Sequence : ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP
Endotoxin : Less than 1 EU/µg of rMuTARC/CCL17 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
SDS-PAGE of Ccl17-622M :

Gene Name : Ccl17
Official Symbol : Ccl17
Synonyms : CCL17; chemokine (C-C motif) ligand 17; small inducible cytokine subfamily A17; Tarc; Abcd-2; Scya17; Scya17l;
Gene ID : 20295
mRNA Refseq : NM_011332
Protein Refseq : NP_035462
UniProt ID : F6R5P4

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.