| Description : |
Thymosin Beta 4 is a naturally occurring peptide encoded by the TMSB4X gene located on Chr. X in humans. It is found in high concentrations in blood platelets, wound fluid and other tissues in the body. Tβ-4 is a major actin regulating peptide and the primary function is to stimulate the productions of T cells, which plays important part of the immune system. The thymosin beta-4 peptide, if used after a heart attack, might reactivate cardiac progenitor cells to repair damaged heart tissue. |
| Source : |
E.coli |
| Species : |
Human |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4. |
| Bio-activity : |
Fully biologically active when compared to standard. The biological activity determined by its ability to produce a protective effect against hydrogen peroxide in primary lung fibroblasts is in a concentration range of 0.5 - 10 μg/ml. |
| Molecular Mass : |
Approximately 4.9 kDa, a single non-glycosylated polypeptide chain containing 43 amino acids. |
| Protein length : |
43 |
| AA Sequence : |
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Endotoxin : |
Less than 1 EU/µg of rHuTβ4 as determined by LAL method. |
| Purity : |
>97% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
