"PDGFA" Related Products

Expand
Expand
Expand

Recombinant Human PDGFA protein

Cat.No. : PDGFA-57H
Product Overview : Recombinant Human PDGFA(Ser87-Thr211) was expressed in E. coli.
Source : E. coli
Species : Human
Form : Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4
Protein length : Ser87-Thr211
AA Sequence : SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVK VAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping : The product is shipped at ambient temperature.
Gene Name : PDGFA platelet-derived growth factor alpha polypeptide [ Homo sapiens ]
Official Symbol : PDGFA
Synonyms : PDGFA; platelet-derived growth factor alpha polypeptide; platelet-derived growth factor subunit A; PDGF A chain; PDGF A; PDGF1; platelet derived growth factor alpha chain; PDGF-1; PDGF A-chain; PDGF subunit A; platelet-derived growth factor A chain; platelet-derived growth factor alpha chain; platelet-derived growth factor alpha isoform 2 preproprotein; PDGF-A;
Gene ID : 5154
mRNA Refseq : NM_002607
Protein Refseq : NP_002598
MIM : 173430
UniProt ID : P04085
Chromosome Location : 7p22
Pathway : Ceramide signaling pathway, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; Downstream signal transduction, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem;
Function : cell surface binding; collagen binding; eukaryotic cell surface binding; growth factor activity; platelet-derived growth factor binding; platelet-derived growth factor receptor binding; contributes_to platelet-derived growth factor receptor binding; platelet-derived growth factor receptor binding; protein heterodimerization activity; protein homodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.