"CXCL12" Related Products

Expand
Expand

Recombinant Human CXCL12

Cat.No.: CXCL12-105H
Product Overview: Recombinant Human CXCL12 was expressed in E. coli.
Description: This gene encodes a stromal cell-derived alpha chemokine member of the intercrine family. The encoded protein functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4, and plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Mutations in this gene are associated with resistance to human immunodeficiency virus type 1 infections. Multiple transcript variants encoding different isoforms have been found for this gene.
Source: E. coli
Species: Human
Tag: Biotin
Form: Lyophilized
Bio-activity: EC50 = 2.5nM determined by Calcium Flux with recombinant human CXCR4 cells Confirmation of Migration with U937 cells expressing CXCR4 was confirmed
Molecular Mass: 10.4kDa
AA Sequence: KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKKLGSGLN DIFEAQKIEWHE
Endotoxin: <0.01 EU per 1μg of the protein by the LAL method
Purity: > 97% by SDS PAGE
Storage: Avoid repeated freeze-thaw cycles • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution.
Reconstitution: Recommended at 100μg/mL in sterile water
Gene Name: CXCL12 chemokine (C-X-C motif) ligand 12 [ Homo sapiens (human) ]
Official Symbol: CXCL12
Synonyms: CXCL12; IRH; PBSF; SDF1; TLSF; TPAR1; SCYB12; chemokine (C-X-C motif) ligand 12; stromal cell-derived factor 1; intercrine reduced in hepatomas; pre-B cell growth-stimulating factor
Gene ID: 6387
mRNA Refseq: NM_000609
Protein Refseq: NP_000600
MIM: 600835
UniProt ID: P48061
Chromosome Location: 10q11.1
Pathway: CXCR4-mediated signaling events; Chemokine receptors bind chemokines; Chemokine signaling pathway
Function: CXCR chemokine receptor binding; chemokine activity; receptor binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.