"GAPDH" Related Products

Expand
Expand
Expand

Recombinant Human GAPDH, GST-tagged

Cat.No.: GAPDH-117H
Product Overview: Human GAPDH full-length ORF (1 a.a. - 335 a.a.) recombinant protein with GST-tag at N-terminal.
Description: The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome. Two transcript variants encoding different isoforms have been found for this gene.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 62.59 kDa
AA Sequence: MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPIT IFQERDPSKIKWGDAGAEYVVESTG VFTTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISN ASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGR GALQNIIPASTGAAKAVGKVIPE LNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAG AG IALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: GAPDH glyceraldehyde-3-phosphate dehydrogenase [ Homo sapiens (human) ]
Official Symbol: GAPDH
Synonyms: GAPDH; G3PD; GAPD; glyceraldehyde-3-phosphate dehydrogenase; aging-associated gene 9 protein; peptidyl-cysteine S-nitrosylase GAPDH; EC 1.2.1.12
Gene ID: 2597
mRNA Refseq: NM_002046
Protein Refseq: NP_002037
MIM: 138400
UniProt ID: P04406
Chromosome Location: 12p13
Pathway: Alzheimer''s disease; Biosynthesis of amino acids; Carbon metabolism
Function: NAD binding; glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity; identical protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.