"IL12B" Related Products

Recombinant Human IL12B, His-tagged

Cat.No.: IL12B-141H
Product Overview: Recombinant human Interleukin-12 p40 is a glycosylated polypeptide chain containing 312 amino acids ( fragment 23 - 328 P29460 IL12B_HUMAN) with an amino- terminal hexahistidine tag. The recombinant protein has a predicted molecular mass of 35.5kDa, however as a result of potential glycosylation, the molecular mass could be approximately 40kDa by SDSPAGE under reducing conditions. Human recombinant protein expressed in Nicotiana benthamiana. Recombinant human Interleukin-12 subunit p40 contains a 6-His-tag at the N-terminal end, is produced by transient expression in non-transgenic plants and is purified by sequential chromatography (FPLC). This product contains no animal–derived components or impurities. Animal free product.
Description: Interleukin-12 (IL-12) is a heterodimer cytokine composed of p40 and p35 subunits. It is mainly produced by macrophages, dendritic cells, and B cells. It has multiple effects on T and natural killer (NK) cells. In particular it appears to be a major factor for the development of cellular immunity. IL-12 stimulates the production and secretion of several cytokines, in particular IFN-γ, by NK cells and T cells, induces proliferation and enhances the cytotoxic activity within these cell populations. The p40 subunit of IL-12 interacts with the beta subunit of IL-12R and the disulphide linked p40 homodimer specifically antagonize the activity of bioactive IL-12 in different assay systems.
Source: Nicotiana benthamiana
Species: Human
Tag: His
Form: Recombinant human Interleukin-12p40 is lyophilized from 10mM PBS buffer pH 7.6 and 0.2 M NaCl.
Bio-activity: The biological activity of IL12 p40 is determined by the dose dependent inhibition of IL-12 dependent IFN-gamma production (mouse splenocytes).
Molecular Mass: Recombinant human Interleukin-12 p40 is a glycosylated polypeptide chain containing 312 amino acids ( fragment 23 - 328 P29460 IL12B_HUMAN) with an amino- terminal hexahistidine tag. The recombinant protein has a predicted molecular mass of 35.5kDa, ho
AA Sequence: HHHHHHIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCH KGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQ GVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNL QLKPLKNSRQVEVSWEYPDTWSTPHSYFSL
Endotoxin: < 0.04 eu ug protein (lal>
Purity: >97% by SDS-PAGE gel
Applications: Western blot, Immunogen
Storage: This lyophilized preparation is stable at 2-8o C. For long storage it should be kept at -20oC. It is recommended to add a carrier protein (0.1% HSA or BSA). Repeated freezing and thawing is not recommended.
Reconstitution: Lyophilized protein should be reconstituted in water to a concentration of 50 ng/ul. Upon reconstitution, It can be stored in working aliquots at –20°C for future use. Optimal reconstitution please follow batch Quality Control sheet instructions.
Gene Name: IL12B interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) [ Homo sapiens ]
Official Symbol: IL12B
Synonyms: IL12B; interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40); NKSF2; interleukin-12 subunit beta; CLMF; CLMF2; cytotoxic lymphocyte maturation factor 2; p40; IL 12B; IL12; subunit p40; interleukin 12; interleukin 12 beta chain; natural killer cell stimulatory factor; 40 kD subunit; natural killer cell stimulatory factor 2; NKSF; CLMF p40; IL-12 subunit p40; IL12, subunit p40; interleukin 12, p40; interleukin-12 beta chain; NK cell stimulatory factor chain 2; cytotoxic lymphocyte maturation factor 40 kDa subunit; natural killer cell stimulatory factor, 40 kD subunit; IL-12B;
Gene ID: 3593
mRNA Refseq: NM_002187
Protein Refseq: NP_002178
MIM: 161561
UniProt ID: P29460
Chromosome Location: 5q31.1-q33.1
Pathway: African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem;
Function: contributes_to cytokine activity; cytokine receptor activity; contributes_to growth factor activity; identical protein binding; interleukin-12 alpha subunit binding; interleukin-12 receptor binding; contributes_to interleukin-12 receptor binding; contributes_to interleukin-23 receptor binding; protein binding; protein heterodimerization activity; protein homodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.