"TNFRSF11B" Related Products

Expand
Expand

Recombinant Human TNFRSF11B protein, Fc-tagged

Cat.No. : TNFRSF11B-142H
Product Overview : Recombinant Human TNFRSF11B protein was expressed in yeast with Fc tag.
Description : Osteoprotegerin (OPG), also named osteoclastogenesis inhibitory factor (OCIF), and tumor necrosis factor receptor superfamily member 11B (TNFRSF11B), is a TNFRSF11B-encoded protein in humans. OPG is a 401 a.a. basic glycoprotein which comprises 7 structural domains. It is either a 60 kDa monomer or a 120 kDa dimer linked by disulfide bridges. OPG acts as a decoy receptor for the receptor activator of nuclear factor kappa B ligand (RANKL) and inhibits the activation of osteoclasts and promotes osteoclast apoptosis in vitro and may also play a role in preventing arterial calcification. OPG has been applied to decrease bone resorption in women with postmenopausal osteoporosis and in patients with lytic bone metastases. Mature human OPG shares 86 %, 87 %, 92 %, 92 % and 88 % amino acid sequence identity with mouse, rat, equine, canine and bovine OPG, respectively.
Source : Yeast
Species : Human
Tag : Fc
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 6.0, 150 mM NaCl, 0.02 % Tween-80.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by neutralizing the stimulation of U937 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 105 IU/mg in the presence of 10 ng/mL soluble rHuRANKL (sRANKL).
Molecular Mass : Approximately 109.6 kDa, a disulfide-linked homodimeric protein containing two 412 amino acids.
Protein length : 412
AA Sequence : ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLEPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : Less than 1 EU/μg of rHuOPG-Fc as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : TNFRSF11B
Official Symbol : TNFRSF11B
Synonyms : TNFRSF11B; tumor necrosis factor receptor superfamily, member 11b; OPG, osteoprotegerin; tumor necrosis factor receptor superfamily member 11B; OCIF; TR1; osteoprotegerin; osteoclastogenesis inhibitory factor; OPG; MGC29565;
Gene ID : 4982
mRNA Refseq : NM_002546
Protein Refseq : NP_002537
MIM : 602643
UniProt ID : O00300

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.