"WNT1" Related Products

Expand
Expand

Recombinant Human WNT1, StrepII-tagged

Cat.No.: WNT1-204H
Product Overview: Purified, full-length human recombinant WNT1 protein (amino acids 28-370, 343 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 38.3 kDa. (Accession NP_005421.1; UniProt P04628)
Description: The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This protein is a member of the WNT family. It is very conserved in evolution, and the protein is 98% identical to the mouse Wnt1 protein at the amino acid level. The studies in mouse indicate that the Wnt1 protein functions in the induction of the mesencephalon and cerebellum.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 28-370, 343 a.a.
AA Sequence: ANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRW NCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFG RLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDG ASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCEL LCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL
Endotoxin: <0.1 eu per ug protein by lal
Purity: >95% pure by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4??C after reconstitution. Avoid freeze/thaw cycles. - See more at: http://www.genemed.com/90001#sthash.FsM1acyN.dpuf
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: WNT1 wingless-type MMTV integration site family, member 1 [ Homo sapiens ]
Official Symbol: WNT1
Synonyms: WNT1; wingless-type MMTV integration site family, member 1; INT1; proto-oncogene Wnt-1; proto-oncogene Int-1 homolog; wingless-type MMTV integration site family, member 1 (oncogene INT1);
Gene ID: 7471
mRNA Refseq: NM_005430
Protein Refseq: NP_005421
MIM: 164820
UniProt ID: P04628
Chromosome Location: 12q13
Pathway: Adipogenesis, organism-specific biosystem; Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; C-MYB transcription factor network, organism-specific biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; Developmental Biology, organism-specific biosystem;
Function: cytokine activity; frizzled binding; frizzled-2 binding; protein binding; protein domain specific binding; receptor agonist activity; transcription regulatory region DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.