"WNT5B" Related Products

Expand
Expand
Expand

Recombinant Human WNT5B, StrepII-tagged

Cat.No.: WNT5B-207H
Product Overview: Purified, full-length human recombinant WNT5B protein (amino acids 18-359, 342 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 38.5 kDa. (Accession NP_110402.2; UniProt Q9H1J7)
Description: Wnt5B is a ligand for members of the frizzled family of seven transmembrane receptors. It is a probable developmental protein and may be a signaling molecule which affects the development of discrete regions of tissues. It is likely to signal over only few cell diameters. The protein belongs to the Wnt family.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 18-359, 342 a.a.
AA Sequence: QLLTDANSWWSLALNPVQRPEMFIIGAQPVCSQLPGLSPGQRKLCQLYQEHMAYIGEGAKTGIKECQHQFRQRRW NCSTADNASVFGRVMQIGSRETAFTHAVSAAGVVNAISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEY GYRFAKEFVDAREREKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKVG DRLKEKYDSAAAMRVTRKGRLELVNSRFTQPTPEDLVYVDPSPDYCLRNESTGSLGTQGRLCNKTSEGMDGCELM CCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCTEIVDQYICK
Endotoxin: <0.1 eu per ug protein by lal
Purity: >95% pure by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: WNT5B wingless-type MMTV integration site family, member 5B [ Homo sapiens ]
Official Symbol: WNT5B
Synonyms: WNT5B; wingless-type MMTV integration site family, member 5B; protein Wnt-5b; WNT-5B protein; MGC2648;
Gene ID: 81029
mRNA Refseq: NM_030775
Protein Refseq: NP_110402
MIM: 606361
UniProt ID: Q9H1J7
Chromosome Location: 12p13.3
Pathway: Adipogenesis, organism-specific biosystem; Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Hedgehog signaling pathway, organism-specific biosystem;
Function: frizzled-2 binding; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.