"WNT7A" Related Products

Expand
Expand
Expand

Recombinant Human WNT7A, StrepII-tagged

Cat.No.: WNT7A-208H
Product Overview: Purified, full-length human recombinant WNT7A protein (amino acids 32-349, 318 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 35.6 kDa. (Accession NP_004616.2; UniProt O00755)
Description: Wnt7a is a ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. Signaling by Wnt-7a allows sexually dimorphic development of the mullerian ducts.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 32-349, 318 a.a.
AA Sequence: LGASIICNKIPGLAPRQRAICQSRPDAIIVIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAF TYAIIAAGVAHAITAACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLMN LHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNKRPTFLKIKK PLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQASGCDLMCCGRGYNTHQYARVWQCNCKFHWC CYVKCNTCSERTEMYTCK
Endotoxin: <0.1 eu per ug protein by lal
Purity: >95% pure by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: WNT7A wingless-type MMTV integration site family, member 7A [ Homo sapiens ]
Official Symbol: WNT7A
Synonyms: WNT7A; wingless-type MMTV integration site family, member 7A; protein Wnt-7a; proto oncogene Wnt7a protein; proto-oncogene Wnt7a protein;
Gene ID: 7476
mRNA Refseq: NM_004625
Protein Refseq: NP_004616
MIM: 601570
UniProt ID: O00755
Chromosome Location: 3p25
Pathway: Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem;
Function: cytokine activity; frizzled binding; receptor agonist activity; receptor agonist activity; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.