"WNT8B" Related Products

Expand
Expand

Recombinant Human WNT8B, StrepII-tagged

Cat.No.: WNT8B-210H
Product Overview: Purified, full-length human recombinant WNT8B protein (amino acids 23-351, 329 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 35.2 kDa. (Accession NP_003384.2; UniProt Q93098)
Description: Wnt8b is a ligand for members of the frizzled family of seven transmembrane receptors. It may play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 23-351, 329 a.a.
AA Sequence: WSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVM YTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAV KGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELV HLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCE QCRRRVTKYFCSRAERPRGGAAHKPGRKP
Endotoxin: <0.1 eu per ug protein by lal
Purity: >95% pure by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: WNT8B wingless-type MMTV integration site family, member 8B [ Homo sapiens ]
Official Symbol: WNT8B
Synonyms: WNT8B; wingless-type MMTV integration site family, member 8B; protein Wnt-8b;
Gene ID: 7479
mRNA Refseq: NM_003393
Protein Refseq: NP_003384
MIM: 601396
UniProt ID: Q93098
Chromosome Location: 10q24
Pathway: Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Hedgehog signaling pathway, organism-specific biosystem;
Function: G-protein coupled receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.