"IGF2" Related Products

Expand
Expand
Expand

Recombinant Human IGF2, StrepII-tagged

Cat.No.: IGF2-212H
Product Overview: Purified, full-length human recombinant IGF2 protein (amino acids 93-126, 34 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 4 kDa. (Accession NP_000603.1; UniProt P01344)
Description: IGF2 is a member of the insulin family of polypeptide growth factors, which are involved in development and growth. In vitro, they are potent mitogens for cultured cells. IGF-II is influenced by placental lactogen and may play a role in fetal development. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 93-126, 34 a.a.
AA Sequence: DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRL
Endotoxin: <0.1 eu per ug protein by lal
Purity: >95% pure by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: IGF2 insulin-like growth factor 2 (somatomedin A) [ Homo sapiens ]
Official Symbol: IGF2
Synonyms: IGF2; insulin-like growth factor 2 (somatomedin A); C11orf43, chromosome 11 open reading frame 43; insulin-like growth factor II; FLJ44734; somatomedin-A; insulin-like growth factor type 2; IGF-II; PP9974; C11orf43; FLJ22066;
Gene ID: 3481
mRNA Refseq: NM_000612
Protein Refseq: NP_000603
UniProt ID: P01344
Chromosome Location: 11p15.5
Pathway: Apoptosis, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; Hedgehog Signaling Pathway, organism-specific biosystem; Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs), organism-specific biosystem;
Function: growth factor activity; hormone activity; insulin receptor binding; insulin-like growth factor receptor binding; protein binding; protein serine/threonine kinase activator activity; receptor activator activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.