Recombinant Human EGF, StrepII-tagged

Cat.No.: EGF-214H
Product Overview: Purified, full-length human recombinant Epidermal growth factor or EGF protein (amino acids 971-1023, 53 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 6.2 kDa. (Accession NP_001954.2; UniProt P01133)
Description: EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 971-1023, 53 a.a.
AA Sequence: NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Endotoxin: <0.1 eu per ug protein by lal
Purity: >95% pure by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: EGF epidermal growth factor [ Homo sapiens ]
Official Symbol: EGF
Synonyms: EGF; epidermal growth factor; epidermal growth factor (beta urogastrone); pro-epidermal growth factor; beta-urogastrone; URG; HOMG4;
Gene ID: 1950
mRNA Refseq: NM_001178130
Protein Refseq: NP_001171601
MIM: 131530
UniProt ID: P01133
Chromosome Location: 4q25
Pathway: Arf6 signaling events, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Ceramide signaling pathway, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem;
Function: calcium ion binding; epidermal growth factor receptor binding; growth factor activity; protein binding; transmembrane receptor protein tyrosine kinase activator activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.