"IL22" Related Products

Expand
Expand
Expand

Recombinant Human IL22, StrepII-tagged

Cat.No.: IL22-215H
Product Overview: Purified, full-length human recombinant Interleukin 22 or IL22 protein (amino acids 34-179, 146 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 16.7 kDa. (Accession NP_065386.1; UniProt Q9GZX6)
Description: IL22 acts primarily on epithelial cells and is involved in inflammatory response. The cytokine induces multiple signaling pathways that help prevent tissue damage during inflammation. IL22 levels are often up-regulated in many chronic inflammatory conditions. This protein is a member of IL10 family.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 34-179, 146 a.a.
AA Sequence: APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQS DRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Endotoxin: <0.1 eu per ug protein by lal
Purity: >95% pure by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: IL22 interleukin 22 [ Homo sapiens ]
Official Symbol: IL22
Synonyms: IL22; interleukin 22; interleukin-22; IL 10 related T cell derived inducible factor; IL 21; IL 22; IL D110; IL TIF; ILTIF; MGC79382; MGC79384; TIFa; TIFIL 23; zcyto18; cytokine Zcyto18; IL-10-related T-cell-derived inducible factor; IL-10-related T-cell-derived-inducible factor; IL-21; IL-22; IL-TIF; IL-D110; TIFIL-23;
Gene ID: 50616
mRNA Refseq: NM_020525
Protein Refseq: NP_065386
MIM: 605330
UniProt ID: Q9GZX6
Chromosome Location: 12q15
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem;
Function: cytokine activity; interleukin-22 receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.