"FGF7" Related Products

Expand
Expand

Recombinant Human FGF7, StrepII-tagged

Cat.No.: FGF7-218H
Product Overview: Purified, full-length human recombinant Fibroblast growth factor 7 or FGF7 protein (amino acids 32-194, 163 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 18.9 kDa. (Accession NP_002000.1; UniProt P21781)
Description: FGF7 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth. and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development, and early lung organogenesis.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 32-194, 163 a.a.
AA Sequence: CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVG IVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKK EQKTAHFLPMAIT
Endotoxin: <0.1 eu per ug protein by lal
Purity: >95% pure by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: FGF7 fibroblast growth factor 7 [ Homo sapiens ]
Official Symbol: FGF7
Synonyms: FGF7; fibroblast growth factor 7; fibroblast growth factor 7 (keratinocyte growth factor); keratinocyte growth factor; KGF; FGF-7; heparin-binding growth factor 7; HBGF-7;
Gene ID: 2252
mRNA Refseq: NM_002009
Protein Refseq: NP_002000
MIM: 148180
UniProt ID: P21781
Chromosome Location: 15q21.2
Pathway: Downstream signaling of activated FGFR, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; FGFR2 ligand binding and activation, organism-specific biosystem; FGFR2b ligand binding and activation, organism-specific biosystem; FRS2-mediated cascade, organism-specific biosystem; Glypican 3 network, organism-specific biosystem; IRS-mediated signalling, organism-specific biosystem;
Function: chemoattractant activity; growth factor activity; heparin binding; type 2 fibroblast growth factor receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.